| Antigenic Specificity |
AASDHPPT |
| Clone |
polyclonal |
| Host Species |
Mouse |
| Reactive Species |
human. other species not tested. |
| Isotype |
n/a |
| Format |
whole antisera |
| Size |
0.05ml |
| Applications |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Description |
Specificity: AASDHPPT - aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase. Epitope: MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSS. Immunogen: AASDHPPT (NP_056238, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. |
| Catalog # |
H00060496-A01 |
| Price |
$250.00 |
| Other Names |
AASD-PPT, CGI-80, DKFZp566E2346, LYS2, LYS5. SwissProt ID: NP_056238 |
| Supplier Data Page |
Anti-AASDHPPT from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
