Anti-ABC2 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ABC2 |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human. |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against C17orf71 and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to C17ORF71 The peptide sequence was selected form the middle region of C17ORF71. Immunogenizing peptide sequence HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF. This product comes as a Lyophilized powder. Reconstitution Instructions: Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. The function of this protein remains unknown. |
| Catalog # |
NBP1-56876 |
| Price |
$325.00 |
| Other Names |
C17orf71. SwissProt ID: Q8ND04 |
| Supplier Data Page |
Anti-ABC2 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
