| Antigenic Specificity |
ABCA10 |
| Clone |
8F4 |
| Host Species |
Mouse |
| Reactive Species |
human. other species not tested. |
| Isotype |
IgG2b kappa |
| Format |
IgG purified |
| Size |
0.1mg |
| Applications |
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Description |
Specificity: ABCA10 - ATP-binding cassette, sub-family A (ABC1), member 10. Epitope: MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCYL. Immunogen: ABCA10 (NP_525021, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. |
| Catalog # |
H00010349-M01 |
| Price |
$315.00 |
| Other Names |
EST698739. SwissProt ID: NP_525021 |
| Supplier Data Page |
Anti-ABCA10 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
