Anti-ABCA12 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ABCA12 |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human. |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against ABCA12 and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to ABCA12(ATP-binding cassette, sub-family A (ABC1), member 12) The peptide sequence was selected form the middle region of ABCA12. Immunogenizing peptide sequence TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV. This product comes as a Lyophilized powder. Reconstitution Instructions:Add 50 μl of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20?C. Avoid repeat freeze-thaw cycles. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct s |
| Catalog # |
NBP1-69304 |
| Price |
$325.00 |
| Other Names |
ABCA12 |
| Supplier Data Page |
Anti-ABCA12 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
