Anti-ABCB4 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ABCB4 |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human. |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against ABCB4 and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to ABCB4(ATP-binding cassette, sub-family B (MDR/TAP), member 4) The peptide sequence was selected form the middle region of ABCB4. Immunogenizing peptide sequence GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV. This product comes as a Lyophilized powder. Reconstitution Instructions: Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily. Member |
| Catalog # |
NBP1-59802 |
| Price |
$325.00 |
| Other Names |
ABCB4 |
| Supplier Data Page |
Anti-ABCB4 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
