| Antigenic Specificity |
ABCC9 |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human,mouse,rat. computational sequence homology: pig:100%; human:100%; guinea pig:100%; mouse-ear cress:100%; rat:100%; rabbit:100%; dog:100%; chicken:100%; bovine:100%; zebrafish:100%; western balsam poplar:100%; castor bean:100%; florida lancelet:100%; mouse:100%; giant panda:100%; african malaria mosquito:92%; slime mold:92%; green puffer:92%; C. elegans:92%; mosquito:92%; |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against ABCC9 and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to ABCC9(ATP-binding cassette, sub-family C (CFTR/MRP), member 9) The peptide sequence was selected form the middle region of ABCC9. Immunogenizing peptide sequence AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK. This product comes as a Lyophilized powder. Reconstitution Instructions: Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. |
| Catalog # |
NBP1-59350 |
| Price |
$325.00 |
| Other Names |
ABCC9. SwissProt ID: O60706 |
| Supplier Data Page |
Anti-ABCC9 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
