| Antigenic Specificity |
ABCD2 |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human. |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against ABCD2 and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to ABCD2(ATP-binding cassette, sub-family D (ALD), member 2) The peptide sequence was selected form the middle region of ABCD2. Immunogenizing peptide sequence WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT. This product comes as a Lyophilized powder. Reconstitution Instructions: Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, M |
| Catalog # |
NBP1-59808 |
| Price |
$325.00 |
| Other Names |
ALDL1, ALDR, ALDRP, ABC39, hALDR. SwissProt ID: Q9UBJ2 |
| Supplier Data Page |
Anti-ABCD2 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
