| Antigenic Specificity |
Abeta 40 |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human, mouse, rat. computational sequence homology: giant panda:100%, common squirrel monkey:100%, guinea pig:100%, sumatran orangutan:100%, chimpanzee:100%, dog:100%, striped dolphin:100%, rabbit:100%, bovine:100%, human:100%, rat:100%, chicken:100%, mouse:100%, crab-eating macaque:100%, pig:100%, Xenopus:92%, african clawed frog:92%, western clawed frog:85%, fruit fly:76%, japanese electric ray:76%, |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against APP and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to APP(amyloid beta (A4) precursor protein (peptidase nexin-II, Alzheimer disease)) The peptide sequence was selected form the middle region of APP. Immunogenizing peptide sequence RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG. |
| Catalog # |
NBP1-59287 |
| Price |
$325.00 |
| Other Names |
AAA, ABETA, ABPP, AD1, APPI, CTFgamma, CVAP, PN2, SwissProt ID: P05067 |
| Supplier Data Page |
Anti-Abeta 40 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
