Anti-ABHD1 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ABHD1 |
| Clone |
polyclonal |
| Host Species |
Mouse |
| Reactive Species |
human. |
| Isotype |
n/a |
| Format |
Protein A purified |
| Size |
0.05mg |
| Applications |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Description |
Specificity: ABHD1 - abhydrolase domain containing 1,. Epitope: MLSSFLSPQNGTWADTFSLLLALAVALYLGYYWACVLQRPRLVAGPQFLAFLEPHCSITTETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQETYVLHLVNQALRDGYQAVVFNNRGCRGEELRTHRAFCASNTEDLETVVNHIKHRYPQAPLLAVGISFGGILVLNHLAQARQAAGLVAALTLSACWDSFETTRSLETPLNSLLFNQPLT. Immunogen: ABHD1 (AAH39576.2, 1 a.a. ~ 405 a.a) full-length human protein. This gene is a member of the AB hydrolase superfamily and encodes a protein with an alpha/beta hydrolase fold. This domain is common to a number of hydrolytic enzymes of widely differing phylogenetic origins and catalytic functions. [provided by RefSeq] |
| Catalog # |
H00084696-B01P |
| Price |
$315.00 |
| Other Names |
FLJ36128, LABH1. SwissProt ID: AAH39576.2 |
| Supplier Data Page |
Anti-ABHD1 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
