Anti-ABHD13 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ABHD13 |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human. computational sequence homology: giant panda:100%; human:100%; bovine:92%; rat:85%; mouse:85%; african clawed frog:78%; western clawed frog:78%; american bullfrog:78%; chicken:78%; |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against ABHD13 and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to ABHD13(abhydrolase domain containing 13) The peptide sequence was selected form the N terminal of ABHD13. Immunogenizing peptide sequence SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN. This product comes as a Lyophilized powder. Reconstitution Instructions: Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
| Catalog # |
NBP1-60026 |
| Price |
$325.00 |
| Other Names |
ABHD13. SwissProt ID: Q7L211 |
| Supplier Data Page |
Anti-ABHD13 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
