| Antigenic Specificity |
Abhd5 |
| Clone |
polyclonal |
| Host Species |
Mouse |
| Reactive Species |
human. other species not tested. |
| Isotype |
n/a |
| Format |
whole antisera |
| Size |
0.05ml |
| Applications |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Description |
Specificity: ABHD5 - abhydrolase domain containing 5. Epitope: FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVK. Immunogen: ABHD5 (NP_057090, 240 a.a. ~ 343 a.a) partial recombinant protein with GST tag. The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. |
| Catalog # |
H00051099-A02 |
| Price |
$250.00 |
| Other Names |
CDS, CGI58, IECN2, MGC8731, NCIE2. SwissProt ID: NP_057090 |
| Supplier Data Page |
Anti-Abhd5 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.