|
|
|
Anti-ABLIM3 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
Anti-ABLIM3 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ABLIM3 |
| Clone |
polyclonal |
| Host Species |
Mouse |
| Reactive Species |
human. |
| Isotype |
n/a |
| Format |
whole antisera |
| Size |
0.05ml |
| Applications |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Description |
Specificity: ABLIM3 - actin binding LIM protein family, member 3,. Epitope: MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMASSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSE. Immunogen: ABLIM3 (-, 1 a.a. ~ 544 a.a) full-length human protein. The LIM domain is a double zinc finger structure that promotes protein-protein interactions. LIM domain proteins, such as ABLIM3, play roles in embryonic development, cell lineage determination, and cancer (Krupp et al., 2006 [PubMed 16328021]).[supplied by OMIM] |
| Catalog # |
H00022885-B01 |
| Price |
$315.00 |
| Other Names |
HMFN1661. SwissProt ID: AAH01665.1 |
| Supplier Data Page |
Anti-ABLIM3 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
|
Link To Us
Bookmark Us
Supplier Login
