| Antigenic Specificity |
ABP1 |
| Clone |
polyclonal |
| Host Species |
Mouse |
| Reactive Species |
human. other species not tested. |
| Isotype |
n/a |
| Format |
whole antisera |
| Size |
0.05ml |
| Applications |
The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. |
| Description |
Specificity: amiloride binding protein 1 (amine oxidase (copper-containing)). Epitope: LHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPRHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHS. Immunogen: ABP1 (NP_001082, 501 a.a. ~ 600 a.a) partial recombinant protein with GST tag. This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. |
| Catalog # |
H00000026-A01 |
| Price |
$250.00 |
| Other Names |
ABP, AOC1, DAO, DAO1, KAO. SwissProt ID: NP_001082 |
| Supplier Data Page |
Anti-ABP1 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
