Anti-ABR Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ABR |
| Clone |
polyclonal |
| Host Species |
Mouse |
| Reactive Species |
human. other species not tested. |
| Isotype |
n/a |
| Format |
whole antisera |
| Size |
0.05ml |
| Applications |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Description |
Specificity: ABR - active BCR-related gene,. Epitope: MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLK. Immunogen: ABR (NP_068781, 1 a.a. ~ 859 a.a) full-length human protein. This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis, suggesting that Rho-related GTPases help coordinate motor skills and balance. Alternatively spliced transcript variants that encode different isoforms have been reported for this gene. |
| Catalog # |
H00000029-B01 |
| Price |
$315.00 |
| Other Names |
MDB. SwissProt ID: NP_068781 |
| Supplier Data Page |
Anti-ABR from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
