| Antigenic Specificity |
ACAA2 |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human,mouse,rat. computational sequence homology: giant panda:100%; human:100%; sumatran orangutan:100%; filobasidiella neoformans:100%; mouse:100%; bovine:100%; rat:100%; pig:92%; western clawed frog:92%; chicken:92%; african clawed frog:92%; smut fungus:90%; red flour beetle:90%; plesiocystis pacifica sir-1:90%; green puffer:85%; florida lancelet:85%; staphylococcus hominis sk119:85%; yellow perch:85%; marine diatom:85%; zebrafish:85%; |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against ACAA2 and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to ACAA2(acetyl-Coenzyme A acyltransferase 2) The peptide sequence was selected form the N terminal of ACAA2. Immunogenizing peptide sequence ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV. This product comes as a Lyophilized powder. Reconstitution Instructions: Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. |
| Catalog # |
NBP1-54746 |
| Price |
$325.00 |
| Other Names |
DSAEC. SwissProt ID: P42765 |
| Supplier Data Page |
Anti-ACAA2 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
