Anti-ACAD11 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ACAD11 |
| Clone |
polyclonal |
| Host Species |
Mouse |
| Reactive Species |
human. other species not tested. |
| Isotype |
n/a |
| Format |
whole antisera |
| Size |
0.05ml |
| Applications |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Description |
Specificity: ACAD11 - acyl-Coenzyme A dehydrogenase family, member 11. Epitope: RIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI. Immunogen: ACAD11 (NP_115545, 678 a.a. ~ 781 a.a) partial recombinant protein with GST tag. |
| Catalog # |
H00084129-A01 |
| Price |
$250.00 |
| Other Names |
FLJ12592. SwissProt ID: NP_115545 |
| Supplier Data Page |
Anti-ACAD11 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
