Anti-ACAD8 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ACAD8 |
| Clone |
polyclonal |
| Host Species |
Mouse |
| Reactive Species |
human. other species not tested. |
| Isotype |
n/a |
| Format |
whole antisera |
| Size |
0.05ml |
| Applications |
Antibody reactive against cell lysate for western blot. It has also been used for ELISA. |
| Description |
Specificity: ACAD8 - acyl-Coenzyme A dehydrogenase family, member 8. Epitope: GEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE. Immunogen: ACAD8 (NP_055199, 306 a.a. ~ 416 a.a) partial recombinant protein with GST tag. Isobutyryl-CoA dehydrogenase (EC 1.3.99), encoded by the ACAD8 gene, catalyzes the third step of the degradation of the branched chain amino acid valine (Nguyen et al., 2002 [PubMed 12359132]).[supplied by OMIM] |
| Catalog # |
H00027034-A01 |
| Price |
$250.00 |
| Other Names |
ACAD-8. SwissProt ID: NP_055199 |
| Supplier Data Page |
Anti-ACAD8 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
