Link To Us Link To Us

Bookmark Us Bookmark Us

Supplier Login Supplier Login

Linscott's Directory of Immunological & Biological Reagents
NOVUS BIOLOGICALS, LLC
 (http://www.novusbio.com)

NOVUS BIOLOGICALS, LLC

8100 Southpark Way, A-8

Littleton CO 80120

Phone: 303-730-1950

Fax: 303-730-1966

Email: novus@novusbio.com

Website: http://www.novusbio.com

 

EUROPEAN OFFICE:
Novus Biologicals, Ltd
Phone: +44 (0)1223 426001
Fax: +44 (0)871 971 1635
Email: europe@novusbio.com
Address: 12 Cambridge Science Park
Cambridge CB4 0FQ, United Kingdom

 

CANADIAN OFFICE:
Novus Biologicals Canada ULC
Phone: 855-668-8722 (855-NOVUS-CA)
Fax: 905-827-6402
Email: canada@novusbio.com
Address: 461 North Service Road West
Unit B37
Oakville, ON L6M 2V5 Canada

 
Anti-ACADL Polyclonal Antibody from NOVUS BIOLOGICALS, LLC

Anti-ACADL Polyclonal Antibody from NOVUS BIOLOGICALS, LLC

Antigenic Specificity ACADL
Clone polyclonal
Host Species Rabbit
Reactive Species human,mouse. computational sequence homology: mouse:100%; human:100%; crab-eating macaque:100%; pig:100%; florida lancelet:92%; rat:92%; bovine:92%; western clawed frog:92%; african clawed frog:92%; tunicate:90%; gamma proteobacterium hdn1:90%; roseovarius sp. 217:90%; oceanicola batsensis htcc2597:90%; green puffer:84%; chicken:84%; giant panda:84%; atlantic salmon:84%; acinetobacter johnsonii sh046:83%; brevundimonas sp. bal3:83%; gamma proteobacterium nor5-3:81%;
Isotype n/a
Format peptide affinity purified
Size 50ug
Applications This is a rabbit polyclonal antibody against ACADL and was validated on Western blot.
Description Immunogen: Synthetic peptides corresponding to ACADL(acyl-Coenzyme A dehydrogenase, long chain) The peptide sequence was selected form the middle region of ACADL. Immunogenizing peptide sequence LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL. This product comes as a Lyophilized powder. Reconstitution Instructions: Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
Catalog # NBP1-54763
Price $325.00
Other Names ACADL. SwissProt ID: P28330
Supplier Data Page Anti-ACADL from NOVUS BIOLOGICALS, LLC
Information on this site comes from many sources, and Linscott's Directory disclaims responsibility for its accuracy. Pricing is supplier's approximate list price, and actual prices may vary.
© 1980 - 2012 Linscott's Directory, Linscott's USA. All rights reserved.