| Antigenic Specificity |
ACADL |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human,mouse. computational sequence homology: mouse:100%; human:100%; crab-eating macaque:100%; pig:100%; florida lancelet:92%; rat:92%; bovine:92%; western clawed frog:92%; african clawed frog:92%; tunicate:90%; gamma proteobacterium hdn1:90%; roseovarius sp. 217:90%; oceanicola batsensis htcc2597:90%; green puffer:84%; chicken:84%; giant panda:84%; atlantic salmon:84%; acinetobacter johnsonii sh046:83%; brevundimonas sp. bal3:83%; gamma proteobacterium nor5-3:81%; |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against ACADL and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to ACADL(acyl-Coenzyme A dehydrogenase, long chain) The peptide sequence was selected form the middle region of ACADL. Immunogenizing peptide sequence LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL. This product comes as a Lyophilized powder. Reconstitution Instructions: Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia. |
| Catalog # |
NBP1-54763 |
| Price |
$325.00 |
| Other Names |
ACADL. SwissProt ID: P28330 |
| Supplier Data Page |
Anti-ACADL from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
