| Antigenic Specificity |
ACADSB |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human,mouse,rat. computational sequence homology: giant panda:100%; human:100%; sumatran orangutan:100%; bovine:100%; crab-eating macaque:100%; rat:100%; mouse:100%; starlet sea anemone:92%; neurospora crassa:92%; western clawed frog:92%; fathead minnow:92%; pyrenophora teres f. teres 0-1:92%; glomerella graminicola m1.001:92%; florida lancelet:92%; glume blotch fungus:92%; african clawed frog:85%; aspergillus nidulans:85%; sartorya fumigata:85%; harpegnathos saltator:85%; aspergillus nidulans fgsc a4:85%; |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against ACADSB and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to ACADSB(acyl-Coenzyme A dehydrogenase, short/branched chain) The peptide sequence was selected form the middle region of ACADSB. Immunogenizing peptide sequence GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG. This product comes as a Lyophilized powder. Reconstitution Instructions: Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB gene product has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. The cDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield a mature peptide of approximately 43.7-kDa. Sequence Note: The 3' UTR extension represented by the RefSeq transcript record was derived from genomic sequence data to optimize consistency to the reference genome assembly. The extent of the UTR extension and the location of the polyA site was based on transcript alignments. |
| Catalog # |
NBP1-54788 |
| Price |
$325.00 |
| Other Names |
ACAD7, 2-MEBCAD, SBCAD. SwissProt ID: P45954 |
| Supplier Data Page |
Anti-ACADSB from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
