Anti-ACBD3 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ACBD3 |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human. |
| Isotype |
n/a |
| Format |
Protein A purified |
| Size |
0.1mg |
| Applications |
Antibody reactive against recombinant protein with GST tag on ELISA and western blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Description |
Specificity: ACBD3 - acyl-Coenzyme A binding domain containing 3,. Epitope: MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTA. Immunogen: ACBD3 (AAH60792.1, 1 a.a. ~ 528 a.a) full-length human protein. The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq] |
| Catalog # |
H00064746-D01P |
| Price |
$345.00 |
| Other Names |
GOCAP1, GOLPH1, GCP60, PAP7. SwissProt ID: AAH60792.1 |
| Supplier Data Page |
Anti-ACBD3 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
