Anti-ACBD4 Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ACBD4 |
| Clone |
polyclonal |
| Host Species |
Mouse |
| Reactive Species |
human. |
| Isotype |
n/a |
| Format |
Protein A purified |
| Size |
0.05mg |
| Applications |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Description |
Specificity: ACBD4 - acyl-Coenzyme A binding domain containing 4,. Epitope: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLE. Immunogen: ACBD4 (NP_078998, 1 a.a. ~ 305 a.a) full-length human protein. This gene encodes a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] |
| Catalog # |
H00079777-B01P |
| Price |
$315.00 |
| Other Names |
FLJ13322, HMFT0700. SwissProt ID: NP_078998 |
| Supplier Data Page |
Anti-ACBD4 from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
