Anti-ACCSL Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ACCSL |
| Clone |
polyclonal |
| Host Species |
Rabbit |
| Reactive Species |
human. |
| Isotype |
n/a |
| Format |
peptide affinity purified |
| Size |
50ug |
| Applications |
This is a rabbit polyclonal antibody against LOC390110 and was validated on Western blot. |
| Description |
Immunogen: Synthetic peptides corresponding to LOC390110(hypothetical protein) The peptide sequence was selected form the N terminal of LOC390110. Immunogenizing peptide sequence MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSR. This product comes as a Lyophilized powder. Reconstitution Instructions:Add 50 μl of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20?C. Avoid repeat freeze-thaw cycles. The exact function of LOC390110 remains unknown. |
| Catalog # |
NBP1-70401 |
| Price |
$325.00 |
| Other Names |
LOC390110 |
| Supplier Data Page |
Anti-ACCSL from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
Link To Us
Bookmark Us
Supplier Login
