|
|
|
Anti-ACD Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
Anti-ACD Polyclonal Antibody from NOVUS BIOLOGICALS, LLC
| Antigenic Specificity |
ACD |
| Clone |
polyclonal |
| Host Species |
Mouse |
| Reactive Species |
human. |
| Isotype |
n/a |
| Format |
Protein A purified |
| Size |
0.05mg |
| Applications |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Description |
Specificity: ACD - adrenocortical dysplasia homolog (mouse),. Epitope: MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLS. Immunogen: ACD (AAH16904.1, 1 a.a. ~ 544 a.a) full-length human protein. This gene encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I. [provided by RefSeq] |
| Catalog # |
H00065057-B01P |
| Price |
$315.00 |
| Other Names |
24432, Pip1, PTOP, TINT1. SwissProt ID: AAH16904.1 |
| Supplier Data Page |
Anti-ACD from NOVUS BIOLOGICALS, LLC |
Information on this site comes from many sources, and Linscott's
Directory disclaims responsibility for its accuracy. Pricing is supplier's
approximate list price, and actual prices may vary.
|
Link To Us
Bookmark Us
Supplier Login
