Edit |   |
---|---|
Product Name | Prostaglandin I Synthase Blocking Peptide |
Description | Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT){3477,3476,3478} · To be used in conjunction with Cayman's PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS. |
Size | 200 µg |
Concentration | n/a |
Applications | Immunoprecipitation, Western Blot |
Other Names | PGI Synthase|PGIS|Prostacyclin Synthase |
Gene, Accession, CAS # | n/a |
Catalog # | 360640-200 |
Price | $132 |
Order / More Info | Prostaglandin I Synthase Blocking Peptide from CAYMAN CHEMICAL COMPANY |
Product Specific References | n/a |