Edit |   |
---|---|
Antigenic Specificity | SUR1 |
Clone | N289/16 |
Host Species | Recombinant Rat |
Reactive Species | rat; mouse; hamster |
Isotype | IgG2b kappa |
Format | purified, Fc-silenced |
Size | 200 µg |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Fc Silent™ anti-SUR1 [N289/16]. This chimeric rat antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. Custom conjugations available: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7 |
Immunogen | This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1. |
Other Names | N289/16R; ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; Abcc8 |
Gene, Accession # | UniProt: Q09429 |
Catalog # | Ab02165-8.4 |
Price | $370 / €315 / £285 |
Order / More Info | SUR1 Antibody from ABSOLUTE ANTIBODY LTD. |
Product Specific References | n/a |