Edit |   |
---|---|
Antigenic Specificity | HP1BP3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HP1BP3 polyclonal antibody, unconjugated |
Immunogen | HP1 BP3 antibody was raised using the middle region of HP1 P3 corresponding to a region with amino acids QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL |
Other Names | heterochromatin protein 1|binding protein 3|heterochromatin protein 1 binding protein 3|HP1BP3|Heterochromatin Protein 1, Binding Protein 3|Hp1bp74|heterochromatin protein 1-binding protein 3|HP1-BP74|im:7157373|wu:fb73a05|wu:fb97a12|fb73a05|fb97a12 |
Gene, Accession # | Gene ID: 15441, 50809, 313647 |
Catalog # | ABIN631715 |
Price | $1020 |
Order / More Info | HP1BP3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |