Search, find, compare suppliers for anti-GCLM antibody, protein, ELISA kits.

Antigenic SpecificityGCLM
Host SpeciesRabbit
Reactive Specieshuman, mouse, rat
Size50 µg
ConcentrationLot specific
ApplicationsWestern Blotting
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionProduct Characteristics: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis.Target Information: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. [provided by RefSeq, Jul 2008].
ImmunogenGCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ
Other NamesGLCLR|GCS light chain|GSC light chain|gamma-ECS regulatory subunit|gamma-glutamylcysteine synthetase regulatory subunit|glutamate--cysteine ligase modifier subunit|glutamate--cysteine ligase regulatory subunit|glutamate-cysteine ligase (gamma-glutamylcysteine synthetase)|regulatory (30.8kD)|glutamate-cysteine ligase modifier subunit delta2 alternative splicing|glutamate-cysteine ligase regulatory protein|glutamate-cysteine ligase modifier subunit|GCLM|Glutamate-Cysteine Ligase, Modifier Subunit|glutamate-cysteine ligase regulatory subunit|PTRG_09814|AI649393|Gcmc|glutamate cysteine ligase (gamma-glutamylcysteine synthetase)|regulatory|glutamate cysteine ligase, modifier subunit|id:ibd3182|wu:fi24c07|zgc:55903|glutamate-cysteine ligase, modifier subunit L homeolog|gclm.L
Gene, Accession #Gene ID: 2730, 14630, 29739
Catalog #ABIN631928
Order / More InfoGCLM Antibody from ANTIBODIES-ONLINE GmbH
Product Specific Referencesn/a
Schloss-Rahe-Str. 15
52072 Aachen GERMANY
P: +49 (0)241 95 163 153
F: +49 (0)241 95 163 155

Orders: orders@antibodies-online.com
Technical Support: support@antibodies-online.com


Return to Antibodies

© 1980 - 2020 Linscott's Directory, Linscott's USA. All rights reserved.