Search, find, compare suppliers for anti-TRPV4 antibody, protein, ELISA kits.

Antigenic SpecificityTRPV4
Host SpeciesRabbit
Reactive Specieshuman
Size50 µg
ConcentrationLot specific
ApplicationsWestern Blotting
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionProduct Characteristics: TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.Target Information: This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Mutations in this gene are the cause of spondylometaphyseal and metatropic dysplasia and hereditary motor and sensory neuropathy type IIC. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010].
ImmunogenTRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Other NamesVR-OAC|transient receptor potential cation channel subfamily V member 4|vanilloid receptor-related osmotically activated channel protein|TRPV4|Transient Receptor Potential Cation Channel, Subfamily V, Member 4|0610033B08Rik|OTRPC4|Trp12|VRL-2|VROAC|osm-9-like TRP channel 4|osmosensitive transient receptor potential channel 4|transient receptor potential protein 12|vanilloid receptor-like channel 2|vanilloid receptor-like protein 2|vanilloid receptor-related osmotically-activated channel|CMT2C|HMSN2C|SMAL|SPSMA|SSQTL1|VRL2|OSM9-like transient receptor potential channel 4|vanilloid receptor-related osmotically activated channel|transient receptor potential cation channel|subfamily 5|member 4|vanilloid receptor-related osmotically activated channel (Vroac)|wu:fp52e02|subfamily V|transient receptor potential cation channel subfamily V member 4-like
Gene, Accession #Gene ID: 59341
Catalog #ABIN633742
Order / More InfoTRPV4 Antibody from ANTIBODIES-ONLINE GmbH
Product Specific Referencesn/a
Schloss-Rahe-Str. 15
52072 Aachen GERMANY
P: +49 (0)241 95 163 153
F: +49 (0)241 95 163 155
Technical Support:

Return to Antibodies

© 1980 - 2020 Linscott's Directory, Linscott's USA. All rights reserved.