COX4I1 Antibody from ATLAS ANTIBODIES AB

Search, find, compare suppliers for anti-COX4I1 antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityCOX4I1
CloneCL3497
Host SpeciesMouse
Reactive Specieshuman, mouse, rat (antigen sequence identity: mouse 79%, rat 81%)
IsotypeIgG1
FormatProtein A purified
Size100 µl
Concentrationn/a
ApplicationsIHC, WB. Genetic validation in WB by siRNA knockdown.
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionMouse anti-human COX4I1 monoclonal antibody. Binds to an epitope located within the peptide sequence VVKSEDFSLP as determined by overlapping synthetic peptides.
ImmunogenRecombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
Other Namescytochrome c oxidase subunit IV isoform 1, COX4, COX4-1
Gene, Accession #Gene ID: 1327, UniProt: P13073, ENSG00000131143
Catalog #AMAb91171
Priceplease inquire
Order / More InfoCOX4I1 Antibody from ATLAS ANTIBODIES AB
Product Specific Referencesn/a
ATLAS ANTIBODIES AB
ATLAS ANTIBODIES AB
ATLAS ANTIBODIES AB
Voltavägen 13A
SE-168 69 Bromma SWEDEN
P: +46 8 54 59 58 50
F: +46 8 54 59 58 51

contact@atlasantibodies.com

http://www.atlasantibodies.com

Profile of ATLAS ANTIBODIES AB
Return to Antibodies

© 1980 - 2019 Linscott's Directory, Linscott's USA. All rights reserved.