GLI1 Antibody from ATLAS ANTIBODIES AB

Search, find, compare suppliers for anti-GLI1 antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityGLI1
Clonepolyclonal
Host SpeciesRabbit
Reactive Specieshuman (antigen sequence identity: mouse 88%, rat 91%)
Isotypen/a
Formatantigen affinity purified
Size100 µl
Concentrationn/a
ApplicationsICC-IF
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionRabbit anti-human GLI1 polyclonal antibody.
ImmunogenRecombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS
Other NamesGLI family zinc finger 1, GLI
Gene, Accession #Gene ID: 2735, UniProt: P08151, ENSG00000111087
Catalog #HPA065172
Priceplease inquire
Order / More InfoGLI1 Antibody from ATLAS ANTIBODIES AB
Product Specific Referencesn/a
ATLAS ANTIBODIES AB
ATLAS ANTIBODIES AB
ATLAS ANTIBODIES AB
Voltavägen 13A
SE-168 69 Bromma SWEDEN
P: +46 8 54 59 58 50
F: +46 8 54 59 58 51

contact@atlasantibodies.com

http://www.atlasantibodies.com

Profile of ATLAS ANTIBODIES AB
Return to Antibodies

© 1980 - 2019 Linscott's Directory, Linscott's USA. All rights reserved.