ROBO1 Antibody from ATLAS ANTIBODIES AB

Search, find, compare suppliers for anti-ROBO1 antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityROBO1
Clonepolyclonal
Host SpeciesRabbit
Reactive Specieshuman (antigen sequence identity: mouse 92%, rat 89%)
Isotypen/a
Formatantigen affinity purified
Size100 µl
Concentrationn/a
ApplicationsICC-IF
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionRabbit anti-ROBO1 polyclonal antibody
ImmunogenRecombinant Protein Epitope Signature Tag (PrEST) antigen sequence: REVLDGRQVVDMRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQREQANVGRRNIAEMQVLG
Other Namesroundabout guidance receptor 1, DUTT1, FLJ21882, SAX3
Gene, Accession #Gene ID: 6091, ENSG00000169855, UniProt: Q9Y6N7
Catalog #HPA052968
Priceplease inquire
Order / More InfoROBO1 Antibody from ATLAS ANTIBODIES AB
Product Specific Referencesn/a
ATLAS ANTIBODIES AB
ATLAS ANTIBODIES AB
ATLAS ANTIBODIES AB
Voltavägen 13A
SE-168 69 Bromma SWEDEN
P: +46 8 54 59 58 50
F: +46 8 54 59 58 51

contact@atlasantibodies.com

http://www.atlasantibodies.com

Profile of ATLAS ANTIBODIES AB
Return to Antibodies

© 1980 - 2019 Linscott's Directory, Linscott's USA. All rights reserved.