S100B Antibody from ATLAS ANTIBODIES AB

Search, find, compare suppliers for anti-S100B antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityS100B
CloneCL2720
Host SpeciesMouse
Reactive Specieshuman, mouse, rat (antigen sequence identity: mouse 99%, rat 98%)
IsotypeIgG1
FormatProtein A purified
Size100 µl
Concentrationn/a
ApplicationsIHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionMouse anti-human S100B monoclonal antibody.
ImmunogenRecombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Other NamesS100 calcium binding protein B, S100beta
Gene, Accession #Gene ID: 6285, UniProt: P04271, ENSG00000160307
Catalog #AMAb91038
Priceplease inquire
Order / More InfoS100B Antibody from ATLAS ANTIBODIES AB
Product Specific Referencesn/a
ATLAS ANTIBODIES AB
ATLAS ANTIBODIES AB
ATLAS ANTIBODIES AB
Voltavägen 13A
SE-168 69 Bromma SWEDEN
P: +46 8 54 59 58 50
F: +46 8 54 59 58 51

contact@atlasantibodies.com

http://www.atlasantibodies.com

Profile of ATLAS ANTIBODIES AB
Return to Antibodies

© 1980 - 2019 Linscott's Directory, Linscott's USA. All rights reserved.