PIEZO1 / FAM38A, aa2230-2420 Antibody from LIFESPAN BIOSCIENCES INC.

Search, find, compare suppliers for anti-PIEZO1 / FAM38A, aa2230-2420 antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityPIEZO1 / FAM38A, aa2230-2420
Clonepolyclonal
Host SpeciesRabbit
Reactive Specieshuman
Isotypen/a
Formataffinity purified
Size100 µl, 200 µl, 50 µl
Concentrationn/a
ApplicationsWB (1:500 - 1:2000)
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionFAM38A antibody LS-C408766 is an unconjugated rabbit polyclonal antibody to human FAM38A (PIEZO1 ). Validated for WB.
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 2230-2420 of human PIEZO1 (NP_001136336.2). PSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPM
Other NamesPIEZO1, KIAA0233, Protein FAM38A, Protein PIEZO1, FAM38A, Mib
Gene, Accession #PIEZO1, Gene ID: 9780
Catalog #LS-C408766
Priceplease inquire
Order / More InfoPIEZO1 / FAM38A, aa2230-2420 Antibody from LIFESPAN BIOSCIENCES INC.
Product Specific Referencesn/a
LIFESPAN BIOSCIENCES INC.
LIFESPAN BIOSCIENCES INC.
LIFESPAN BIOSCIENCES INC.
2401 Fourth Avenue, Suite 900
Seattle WA 98121
P: 206-374-1102
P: 866-819-4732 (toll free N. America)
F: 206-577-4565

customer.support@lsbio.com
Orders: Orders@LSBio.com
Tech Support: Technical.Support@LSBio.com

http://www.LSBio.com

Profile of LIFESPAN BIOSCIENCES INC.
Return to Antibodies

© 1980 - 2020 Linscott's Directory, Linscott's USA. All rights reserved.