Search, find, compare suppliers for anti-UCP1 / UCP-1 antibody, protein, ELISA kits.

Antigenic SpecificityUCP1 / UCP-1
Host SpeciesRabbit
Reactive Speciesmouse, rat
Formatantigen affinity purified
Size100 µg
ApplicationsWB (0.5 - 1 µg/ml)
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionUCP1 / UCP-1 Antibody LS-C782827
ImmunogenAmino acids 134-165 (TEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIA) were used as the immunogen for the UCP1 antibody.
Other NamesUCP1, Thermogenin, SLC25A7, UCP-1, UCP 1
Gene, Accession #UCP1, Gene ID: 7350
Catalog #LS-C782827-100
Priceplease inquire
Order / More InfoUCP1 / UCP-1 Antibody from LIFESPAN BIOSCIENCES INC.
Product Specific Referencesn/a
2401 Fourth Avenue, Suite 900
Seattle WA 98121
P: 206-374-1102
P: 866-819-4732 (toll free N. America)
F: 206-577-4565

Orders: Orders@LSBio.com
Tech Support: Technical.Support@LSBio.com


Return to Antibodies

© 1980 - 2022 Linscott's Directory, Linscott's USA. All rights reserved.