VR1 / TRPV1 Antibody from LIFESPAN BIOSCIENCES INC.

Search, find, compare suppliers for anti-VR1 / TRPV1 antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityVR1 / TRPV1
Clonepolyclonal
Host SpeciesRabbit
Reactive Speciesmouse, rat, human
Isotypen/a
Formataffinity purified
Size200 µl
Concentrationn/a
ApplicationsWB (1:500 - 1:2000)
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionVR1 / TRPV1 Antibody LS-C410098. Specificity: Human VR1 / TRPV1
ImmunogenA synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPV1 (NP_061197.4). IAYSSSETPNRHDMLLVEPLNRLLQDKWDRFVKRIFYFNFLVYCLYMIIFTMAAYYRPVDGLPPFKMEKTGDYFRVTGEILSVLGGVYFFFRGIQYFLQRR
Other NamesTRPV1, Capsaicin receptor, OTRPC1, Vanilloid receptor subtype 1, Osm-9-like TRP channel 1, Vanilloid receptor 1, VR1
Gene, Accession #TRPV1, Gene ID: 7442
Catalog #LS-C410098-200
Priceplease inquire
Order / More InfoVR1 / TRPV1 Antibody from LIFESPAN BIOSCIENCES INC.
Product Specific Referencesn/a
LIFESPAN BIOSCIENCES INC.
LIFESPAN BIOSCIENCES INC.
LIFESPAN BIOSCIENCES INC.
2401 Fourth Avenue, Suite 900
Seattle WA 98121
P: 206-374-1102
P: 866-819-4732 (toll free N. America)
F: 206-577-4565

customer.support@lsbio.com
Orders: Orders@LSBio.com
Tech Support: Technical.Support@LSBio.com

http://www.LSBio.com

Profile of LIFESPAN BIOSCIENCES INC.
Return to Antibodies

© 1980 - 2023 Linscott's Directory, Linscott's USA. All rights reserved.