Search, find, compare suppliers for anti-UCP1 / UCP-1 antibody, protein, ELISA kits.

Antigenic SpecificityUCP1 / UCP-1
Host SpeciesRabbit
Reactive Specieshuman
Formatimmunogen affinity purified
Size100 µg
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionUCP1 / UCP-1 Antibody LS-C661943. Specificity: Brown adipose tissue.
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human UCP1 (134-165 aa TEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIA), different from the related mouse and rat sequences by two amino acids.
Other NamesUCP1, Thermogenin, SLC25A7, UCP-1, UCP 1
Gene, Accession #UCP1, Gene ID: 7350
Catalog #LS-C661943-100
Priceplease inquire
Order / More InfoUCP1 / UCP-1 Antibody from LIFESPAN BIOSCIENCES INC.
Product Specific Referencesn/a
2401 Fourth Avenue, Suite 900
Seattle WA 98121
P: 206-374-1102
P: 866-819-4732 (toll free N. America)
F: 206-577-4565

Orders: Orders@LSBio.com
Tech Support: Technical.Support@LSBio.com


Return to Antibodies

© 1980 - 2022 Linscott's Directory, Linscott's USA. All rights reserved.