Edit |   |
---|---|
Antigenic Specificity | DDX6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 0.95 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a member of the DEAD box protein family. The protein is an RNA helicase found in P-bodies and stress granules, and functions in translation suppression and mRNA degradation. It is required for microRNA-induced gene silencing. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human DDX6 (NP 001244120.1). Immunogen Sequence: IQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP |
Other Names | [DDX6; HLR2; P54; RCK; DEAD-box helicase 6] |
Gene, Accession # | [DDX6], Gene ID: 1656, NCBI: P26196.2, UniProt: P26196 |
Catalog # | MBS9140793 |
Price | $260 |
Order / More Info | DDX6 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |