Bcl-X Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Bcl-X antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Bcl-X |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human. |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Bcl-2-like protein 1 (BCL2L1) detection. Background: Bcl-2-like protein 1, also known as Bcl-X, is a protein that in humans is encoded by the BCL2L1 gene. The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which a |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences. |
| Other Names | [Apoptosis regulator BclX; Bcl 2 like 1; Bcl2 like1; Bcl 2 like 1 protein; Bcl xL; BCL XL/S; Bcl xS; BCL2L; BCL2L1; Bclx; Q07817; Bcl-2-like protein 1; BCL2-like 1], [BCL2L1; BCL2L1; BCLX; BCL2L; Bcl-X; PPP1R52; BCL-XL/S; BCL2L; BCLX; Bcl2-L-1] |
| Gene, Accession # | [BCL2L1], Gene ID: 598, NCBI: NP_001182.1, UniProt: Q07817 |
| Catalog # | MBS178417 |
| Price | $315 |
| Order / More Info | Bcl-X Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: BCL2L1 BCL2-like 1.2. Boise LH, Gonzalez-Garcia M, Postema CE, Ding L, Lindsten T, Turka LA, Mao X, Nunez G, Thompson CB (Aug 1993). bcl-x, a bcl-2-related gene that functions as a dominant regulator of apoptotic cell death. Cell 74(4): 597-608. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies