Rad51 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Rad51 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Rad51 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for Rad51 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: DNA repair protein RAD51 homolog 1, also known as RAD51A, is a human gene. The Rad51 gene, HsRAD51, is a homolog of RecA of Escherichia coli and functions in recombination and DNA repair. BRCA1 and BRCA2 proteins form a complex with Rad51, and these genes are thought to participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51 is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intr |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK). |
| Other Names | [DNA repair protein RAD51 homolog 1; HsRAD51; hRAD51; RAD51 homolog A; RAD51; RAD51A; RECA; RAD51 recombinase] |
| Gene, Accession # | [Rad51], Gene ID: 5888, NCBI: NP_001157741.1, UniProt: Q06609 |
| Catalog # | MBS1751209 |
| Price | $315 |
| Order / More Info | Rad51 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Kato, M.; Yano, K.; Matsuo, F.; Saito, H.; Katagiri, T.; Kurumizaka, H.; Yoshimoto, M.; Kasumi, F.; Akiyama, F.; Sakamoto, G.; Nagawa, H.; Nakamura, Y.; Miki, Y.: Identification of Rad51 alteration in patients with bilateral breast cancer. J. Hum. Genet. 45: 133-137, 2000. 2. Daniel DC (2002). Highlight: BRCA1 and BRCA2 proteins in breast cancer.. Microsc. Res. Tech. 59 (1): 68-83. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies