ARID1A Antibody from MYBIOSOURCE INC.

Search, find, compare suppliers for anti-ARID1A antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityARID1A
Clonepolyclonal
Host Speciesn/a
Reactive Specieshuman
Isotypen/a
Formatimmunogen affinity purified
Size0.1 mg
Concentrationn/a
ApplicationsWestern Blot (WB)
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionDescription: Rabbit IgG polyclonal antibody for AT-rich interactive domain-containing protein 1A(ARID1A) detection. Tested with WB in Human. Background: AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the
ImmunogenImmunogen: A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence. Ig Type: Rabbit IgG
Other Names[AT-rich interactive domain-containing protein 1A; actin-dependent regulator of chromatin subfamily F member 1; ARI1A_HUMAN; ARID domain containing protein 1A; ARID domain-containing protein 1A; ARID1A; AT rich interactive domain 1A (SWI like); AT rich interactive domain 1A; AT rich interactive domain containing protein 1A; AT-rich interactive domain-containing protein 1A; B120; BAF250; BAF250A; BM029; brain protein 120; BRG1 associated factor 250; BRG1 associated factor 250a; BRG1-associated factor 250; BRG1-associated factor 250a; C1ORF4; chromatin remodeling factor p250; chromosome 1 open reading frame 4; hELD; hOSA1; matrix-associated; Osa homolog 1; OSA1; OSA1 nuclear protein; P270; SMARCF1; SWI like protein; SWI SNF complex protein p270; SWI-like protein; SWI/SNF complex protein p270; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1; SWI/SNF-related; AT rich interactive domain 1A (SWI-like)], [ARID1A; ARID1A; ELD; B120; CSS2; OSA1; P270; hELD; BM029; MRD14; hOSA1; BAF250; C1orf4; BAF250a; SMARCF1; BAF250; BAF250A; C1orf4; OSA1; SMARCF1; ARID domain-containing protein 1A; BAF250; BAF250A; hOSA1]
Gene, Accession #[ARID1A], Gene ID: 8289, NCBI: NP_006006.3, UniProt: O14497
Catalog #MBS177708
Price$280
Order / More InfoARID1A Antibody from MYBIOSOURCE INC.
Product Specific References1. Dallas, P. B., Pacchione, S., Wilsker, D., Bowrin, V., Kobayashi, R., Moran, E. The human SWI-SNF complex protein p270 is an ARID family member with non-sequence-specific DNA binding activity. Molec. Cell. Biol. 20: 3137-3146, 2000. 2. Krosl, J., Mamo, A., Chagraoui, J., Wilhelm, B. T., Girard, S., Louis, I., Lessard, J., Perreault, C., Sauvageau, G. A mutant allele of the Swi/Snf member BAF250a determines the pool size of fetal liver hemopoietic stem cell populations. Blood 116: 1678-1684, 2010. 3. Nie, Z., Xue, Y., Yang, D., Zhou, S., Deroo, B. J., Archer, T. K., Wang, W. A specificity and targeting subunit of a human SWI/SNF family-related chromatin-remodeling complex. Molec. Cell. Biol. 20: 8879-8888, 2000.
MYBIOSOURCE INC.
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166

sales@mybiosource.com

http://www.MyBioSource.com

Profile of MYBIOSOURCE INC.
Return to Antibodies

© 1980 - 2024 Linscott's Directory, Linscott's USA. All rights reserved.