Kir1.1 (ROMK1) Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Kir1.1 (ROMK1) antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Kir1.1 (ROMK1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.05 mL |
| Concentration | 1ug/ul |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: Mouse-identical, human-45/50 residues identical. Inwardly rectifying K+ channel 1, Kcnj1 Kir1.1 (ROMK1) was the first member of the family of inward rectifying K+ channels to be cloned.1 The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels. The family's topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N-and C-termini. As is the case for the voltage-dependent K+ channels the functional unit for the Kir channels is composed of four subunits that can assembly as either homo or heterotetramers. Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus ma |
| Immunogen | Immunogen: GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK1 (Accession P35560). |
| Other Names | [K ir1-1 (ROMK1)] |
| Gene, Accession # | [Kir1.1] |
| Catalog # | MBS4159229 |
| Price | $725 |
| Order / More Info | Kir1.1 (ROMK1) Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies