Search, find, compare suppliers for anti-ARS2 antibody, protein, ELISA kits.

Antigenic SpecificityARS2
Host SpeciesRabbit
Reactive Specieshuman
Formataffinity purified
Size100 ul
ApplicationsWestern Blot, Immunocytochemistry/Immunofluorescence
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionThe ARS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARS2. This antibody reacts with human. The ARS2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence. Specificity of human ARS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
ImmunogenThe ARS2 Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFRGQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF
Other NamesARS2serrate, arsenate resistance protein 2, arsenate resistance protein ARS2, arsenite resistance protein, Arsenite-resistance protein 2, Asr2, MGC126427, serrate RNA effector molecule homolog, serrate RNA effector molecule homolog (Arabidopsis)
Gene, Accession #SRRT, Gene ID: 51593
Catalog #NBP2-58433
Price$429 / £263 / €342
Order / More InfoARS2 Antibody from NOVUS BIOLOGICALS, LLC
Product Specific Referencesn/a
8100 Southpark Way, A-8
Littleton CO 80120
P: 303-730-1950
F: 303-730-1966

R&D Systems Europe Ltd.
Phone: +44 (0) 1235 529449
Fax: +44 (0) 1235 533420
Address: 19 Barton Lane
Abingdon Science Park
Abingdon, OX14 3NB, UK

Novus Biologicals Canada ULC
Phone: 855-668-8722 (855-NOVUS-CA)
Fax: 905-827-6402
Address: 461 North Service Road West
Unit B37
Oakville, ON L6M 2V5 Canada

Return to Antibodies

© 1980 - 2019 Linscott's Directory, Linscott's USA. All rights reserved.