Sortilin Antibody from NOVUS BIOLOGICALS, LLC

Search, find, compare suppliers for anti-Sortilin antibody, protein, ELISA kits.

Edit 
Antigenic SpecificitySortilin
Clone1B3
Host SpeciesMouse
Reactive Specieshuman, rat
IsotypeIgG2a kappa
FormatIgG purified, no preservative
Size0.1 mg
Concentrationn/a
ApplicationsWestern Blot, ELISA
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionSpecificity: SORT1 - sortilin 1. The Sortilin Antibody (1B3) from Novus Biologicals is a mouse monoclonal antibody to Sortilin. This antibody reacts with human, rat. The Sortilin Antibody (1B3) has been validated for the following applications: Western Blot, ELISA.
ImmunogenSORT1 (NP_002950 203 a.a. - 299 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI
Other Names100 kDa NT receptor, Glycoprotein 95, Gp95LDLCQ6, Neurotensin receptor 3, NT3NTR3, sortilin, sortilin 1
Gene, Accession #SORT1, Gene ID: 6272, Accession: NP_002950, SwissProt: NP_002950
Catalog #H00006272-M01
Price$379 / €387 / £294
Order / More InfoSortilin Antibody from NOVUS BIOLOGICALS, LLC
Product Specific Referencesn/a
NOVUS BIOLOGICALS, LLC
NOVUS BIOLOGICALS, LLC
NOVUS BIOLOGICALS, LLC
8100 Southpark Way, A-8
Littleton CO 80120
P: 303-730-1950
F: 303-730-1966

novus@novusbio.com

http://www.novusbio.com

EUROPEAN OFFICE:
R&D Systems Europe Ltd.
Phone: +44 (0) 1235 529449
Fax: +44 (0) 1235 533420
Email: info@bio-techne.com
Address: 19 Barton Lane
Abingdon Science Park
Abingdon, OX14 3NB, UK

CANADIAN OFFICE:
Novus Biologicals Canada ULC
Phone: 855-668-8722 (855-NOVUS-CA)
Fax: 905-827-6402
Email: canada@novusbio.com
Address: 461 North Service Road West
Unit B37
Oakville, ON L6M 2V5 Canada


Profile of NOVUS BIOLOGICALS, LLC
Return to Antibodies

© 1980 - 2019 Linscott's Directory, Linscott's USA. All rights reserved.