Search, find, compare suppliers for anti-BACE2 antibody, protein, ELISA kits.

Antigenic SpecificityBACE2
Host SpeciesRabbit
Reactive Speciesbovine, porcine, guinea pig, rat, mouse, human
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionRabbit Polyclonal Anti-BACE2 Antibody
ImmunogenThe immunogen for anti-BACE2 antibody: synthetic peptide directed towards the N terminal of human BACE2. Synthetic peptide located within the following region: PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
Other NamesAEPLC, ALP56, ASP1, ASP21, BAE2, CEAP1, DRAP, beta-site APP-cleaving enzyme 2
Gene, Accession #BACE2, Accession: NM_138992
Catalog #TA341894
Order / More InfoBACE2 Antibody from ORIGENE TECHNOLOGIES
Product Specific Referencesn/a
9620 Medical Center Dr. Suite 200
Rockville MD 20850
P: 1-301-340-3188
P: 1-888-267-4436 (U.S. only)
F: 301-340-9254

Return to Antibodies

© 1980 - 2019 Linscott's Directory, Linscott's USA. All rights reserved.