SNRK Antibody from ORIGENE TECHNOLOGIES

Search, find, compare suppliers for anti-SNRK antibody, protein, ELISA kits.

Edit 
Antigenic SpecificitySNRK
Clonepolyclonal
Host SpeciesRabbit
Reactive Speciesbovine, dog, guinea pig, human, mouse, porcine, rabbit
Isotypen/a
Formatunconjugated
Size100 µl
Concentrationn/a
ApplicationsWB
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionRabbit Polyclonal Anti-SNRK Antibody
ImmunogenThe immunogen for Anti-SNRK Antibody: synthetic peptide directed towards the middle region of human SNRK. Synthetic peptide located within the following region: SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN
Other NamesHSNFRK, SNF related kinase
Gene, Accession #SNRK, NM_001100594
Catalog #TA335915
Price$375
Order / More InfoSNRK Antibody from ORIGENE TECHNOLOGIES
Product Specific Referencesn/a
ORIGENE TECHNOLOGIES
ORIGENE TECHNOLOGIES
ORIGENE TECHNOLOGIES
9620 Medical Center Dr. Suite 200
Rockville MD 20850
P: 1-301-340-3188
P: 1-888-267-4436 (U.S. only)
F: 301-340-9254

custsupport@origene.com

http://www.origene.com

Profile of ORIGENE TECHNOLOGIES
Return to Antibodies

© 1980 - 2020 Linscott's Directory, Linscott's USA. All rights reserved.