TRPV4 Antibody from ORIGENE TECHNOLOGIES

Search, find, compare suppliers for anti-TRPV4 antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityTRPV4
Clonepolyclonal
Host SpeciesRabbit
Reactive Speciesrabbit, human, porcine, bovine, rat, dog, mouse, guinea pig
Isotypen/a
Formatunconjugated
Size100 µl
Concentrationn/a
ApplicationsIHC, WB
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionRabbit Polyclonal Anti-TRPV4 Antibody
ImmunogenThe immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Other Namesn/a
Gene, Accession #TRPV4, NM_147204
Catalog #TA338698
Price$375
Order / More InfoTRPV4 Antibody from ORIGENE TECHNOLOGIES
Product Specific Referencesn/a
ORIGENE TECHNOLOGIES
ORIGENE TECHNOLOGIES
ORIGENE TECHNOLOGIES
9620 Medical Center Dr. Suite 200
Rockville MD 20850
P: 1-301-340-3188
P: 1-888-267-4436 (U.S. only)
F: 301-340-9254

custsupport@origene.com

http://www.origene.com

Profile of ORIGENE TECHNOLOGIES
Return to Antibodies

© 1980 - 2020 Linscott's Directory, Linscott's USA. All rights reserved.