Edit |   |
---|---|
Product Name | EP4 Receptor (C-Term) Blocking Peptide |
Description | Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman's EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor. |
Size | 1 ea |
Concentration | n/a |
Applications | Immunofluorescence, Immunohistochemistry, Western Blot |
Other Names | PGE2 Receptor 4|Prostaglandin E2 Receptor 4 |
Gene, Accession, CAS # | n/a |
Catalog # | 301775-200 |
Price | $132.00 |
Order / More Info | EP4 Receptor (C-Term) Blocking Peptide from CAYMAN CHEMICAL COMPANY |
Product Specific References | n/a |