WASL Antibody from ATLAS ANTIBODIES AB

Search, find, compare suppliers for anti-WASL antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityWASL
Clonepolyclonal
Host SpeciesRabbit
Reactive Specieshuman, mouse, rat (antigen sequence identity: mouse 95%, rat 95%)
Isotypen/a
Formatantigen affinity purified
Size100 µl
Concentrationn/a
ApplicationsICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Reviews / Ratings
DescriptionRabbit anti-human WASL polyclonal antibody.
ImmunogenRecombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS
Other NamesWiskott-Aldrich syndrome-like, N-WASP, NWASP
Gene, Accession #Gene ID: 8976, UniProt: O00401, ENSG00000106299
Catalog #HPA005750
Priceplease inquire
Order / More InfoWASL Antibody from ATLAS ANTIBODIES AB
Product Specific Referencesn/a
ATLAS ANTIBODIES AB
ATLAS ANTIBODIES AB
ATLAS ANTIBODIES AB
Voltavägen 13A
SE-168 69 Bromma SWEDEN
P: +46 8 54 59 58 50
F: +46 8 54 59 58 51

contact@atlasantibodies.com

http://www.atlasantibodies.com

Profile of ATLAS ANTIBODIES AB
Return to Antibodies

© 1980 - 2019 Linscott's Directory, Linscott's USA. All rights reserved.