Edit |   |
---|---|
Antigenic Specificity | PAR2/F2RL1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | PAR2/F2RL1 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids. |
Other Names | Proteinase-activated receptor 2;PAR-2;Coagulation factor II receptor-like 1;G-protein coupled receptor 11;Thrombin receptor-like 1;Proteinase-activated receptor 2, alternate cleaved 1;Proteinase-activated receptor 2, alternate cleaved 2;F2RL1;GPR11, PAR2; |
Gene, Accession # | UniProt: P55085 |
Catalog # | orb316563 |
Price | $268 |
Order / More Info | PAR2/F2RL1 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558