Edit |   |
---|---|
Antigenic Specificity | FCGR3A / CD16A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 50 ul |
Concentration | 2.34 mg/ml |
Applications | IHC, IHC-P, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | FCGR3A / CD16A Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human FCGR3A (NP_001121067.1). YFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD |
Other Names | FCGR3A, CD16A, CD16a antigen, CD16, FcgammaRIIIA, FCR-10, FCRIII, Fc gamma receptor III-A, Fc-gamma RIII, Fc-gamma RIII-alpha, FCG3, IGFR3, Fc- gamma riii, Fc-gamma receptor IIIb (CD16), Fc-gamma RIIIa, FCGR3, FCRIIIA, Neutrophil-specific antigen NA, Igg fc receptor iii-1, IgG Fc receptor III-2, Igg fc receptors iii-1, FCGRIII |
Gene, Accession # | n/a |
Catalog # | orb1535797 |
Price | $635 |
Order / More Info | FCGR3A / CD16A Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558